From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: Received: from mp0 ([2001:41d0:2:4a6f::]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)) by ms11 with LMTPS id yFILIGCkxV4nTgAA0tVLHw (envelope-from ) for ; Wed, 20 May 2020 21:42:56 +0000 Received: from aspmx1.migadu.com ([2001:41d0:2:4a6f::]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)) by mp0 with LMTPS id cJnpG2CkxV7SZgAA1q6Kng (envelope-from ) for ; Wed, 20 May 2020 21:42:56 +0000 Received: from lists.gnu.org (lists.gnu.org [209.51.188.17]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by aspmx1.migadu.com (Postfix) with ESMTPS id 0DB47940363 for ; Wed, 20 May 2020 21:42:55 +0000 (UTC) Received: from localhost ([::1]:59110 helo=lists1p.gnu.org) by lists.gnu.org with esmtp (Exim 4.90_1) (envelope-from ) id 1jbWUH-0007oq-Vw for larch@yhetil.org; Wed, 20 May 2020 17:42:54 -0400 Received: from eggs.gnu.org ([2001:470:142:3::10]:50546) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1jbWTK-00079q-GP for guix-devel@gnu.org; Wed, 20 May 2020 17:41:54 -0400 Received: from wout2-smtp.messagingengine.com ([64.147.123.25]:51281) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1jbWTJ-0001c2-EW for guix-devel@gnu.org; Wed, 20 May 2020 17:41:54 -0400 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.west.internal (Postfix) with ESMTP id EB1B913C5; Wed, 20 May 2020 17:41:51 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute4.internal (MEProxy); Wed, 20 May 2020 17:41:52 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm2; bh=eKIimfACB2Pg3zxf27VC9qSkdK ui0uJznfwHro3Wp8s=; b=E7RgBaaRwZcndPHB13h65B5HWTQRvhsbELSOEAUiv3 v+eBxWAEmlaUue4tN9DubwW4+U022ipN32YbkDhsX+H3yCjpy+nGhOumXRiXhMLB uY5d7PrX4johJecnbxOLLi2TVB9BNZPQN56QUGew1Yxnb6VBAedHKLUuAea6DDV8 COsRMhJ3MDVf2CvFDCVL4HEvi7jx2AXxe24QclkqAoiZ3s7B0qbtBqbJ0EFfl++t kZE6bZUuyP4/KOT9g2aGoP0ty60ZyZ2CTafwhqN35f2bzMHagdP2JGOUO88oLwYG y/AEqJSAh0VF5Ty7HkzLLX+JFP327lJD1N8kRXzh+l2A== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=eKIimf ACB2Pg3zxf27VC9qSkdKui0uJznfwHro3Wp8s=; b=uq3EmLM1KJmHgfzCC4liLl izpcbdnupZrT0axy/tzR8739S0voddf4NTT+vFUWMsttdIXs06z8w05pcuXNbJuI I5e3cLNqmx2+MqvQIQo6EAYniHrDk0qMBqHguG/raWj+D36fNBvlyM/+KwaflnVV kVG+Tp+567Tieeg7voJkZAsGdBgzVwEb1ETzOkduYPLAOVe5u1nPtUer73Gvakta QLBAV3zdtUnRT+VS48gfcICAKS7mN1/P5ghJ2Ge2SGEgbpBtvycCeh5ssJARyeZ5 d+f9uJPAI7t+FJ7JCo/JwyJGWTCUcXQfxhwZM/ptvT/f+AB8vyhicpHvJ204v5gA == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduhedruddutdcutefuodetggdotefrodftvfcurf hrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecuuegr ihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjug hrpefhvffujghffgffkfggtgesghdtreertdertdenucfhrhhomhepofgrrhhiuhhsuceu rghkkhgvuceomhgsrghkkhgvsehfrghsthhmrghilhdrtghomheqnecuggftrfgrthhtvg hrnhepudfgffeiuefhhfehteetfeefieelhfeuleeujeehjeegkeejgfefudffudeugfek necuffhomhgrihhnpehgnhhomhgvrdhorhhgpdhgnhhurdhorhhgnecukfhppeekgedrvd dtvddrieekrdejheenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhl fhhrohhmpehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhm X-ME-Proxy: Received: from localhost (ti0006q161-2604.bb.online.no [84.202.68.75]) by mail.messagingengine.com (Postfix) with ESMTPA id 2CF86306645B; Wed, 20 May 2020 17:41:51 -0400 (EDT) From: Marius Bakke To: zimoun Subject: Re: [PATCH] gnu: fontconfig: Add replacement with font-dejavu instead of gs-fonts. In-Reply-To: References: <20200517145012.21532-1-mbakke@fastmail.com> <87ftbubtj2.fsf@devup.no> User-Agent: Notmuch/0.29.3 (https://notmuchmail.org) Emacs/26.3 (x86_64-pc-linux-gnu) Date: Wed, 20 May 2020 23:41:48 +0200 Message-ID: <87imgq9tcz.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" Received-SPF: pass client-ip=64.147.123.25; envelope-from=mbakke@fastmail.com; helo=wout2-smtp.messagingengine.com X-detected-operating-system: by eggs.gnu.org: First seen = 2020/05/20 15:53:59 X-ACL-Warn: Detected OS = Linux 2.2.x-3.x [generic] [fuzzy] X-Spam_score_int: -27 X-Spam_score: -2.8 X-Spam_bar: -- X-Spam_report: (-2.8 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, FREEMAIL_FROM=0.001, RCVD_IN_DNSWL_LOW=-0.7, RCVD_IN_MSPIKE_H4=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_HELO_PASS=-0.001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001 autolearn=_AUTOLEARN X-Spam_action: no action X-BeenThere: guix-devel@gnu.org X-Mailman-Version: 2.1.23 Precedence: list List-Id: "Development of GNU Guix and the GNU System distribution." List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Cc: Guix Devel Errors-To: guix-devel-bounces+larch=yhetil.org@gnu.org Sender: "Guix-devel" X-Scanner: scn0 Authentication-Results: aspmx1.migadu.com; dkim=pass header.d=fastmail.com header.s=fm2 header.b=E7RgBaaR; dkim=pass header.d=messagingengine.com header.s=fm2 header.b=uq3EmLM1; dmarc=pass (policy=none) header.from=fastmail.com; spf=pass (aspmx1.migadu.com: domain of guix-devel-bounces@gnu.org designates 209.51.188.17 as permitted sender) smtp.mailfrom=guix-devel-bounces@gnu.org X-Spam-Score: -1.31 X-TUID: c7cy/q3lS1ox --=-=-= Content-Type: text/plain Content-Transfer-Encoding: quoted-printable zimoun writes: > On Wed, 20 May 2020 at 15:55, Marius Bakke wrote: >> zimoun writes: > >> > Apparently, there is different fonts on master and core-updates, if ye= s why? >> >> The only known difference since the core-updates merge is that >> applications using Pango (e.g. GTK+) no longer recognizes bitmap fonts. >> >> https://gitlab.gnome.org/GNOME/pango/issues/386 > > Thank you for the pointer but I think it is another issue. > > >> > I mean, on my machine -- Guix on the top of Debian with font-dejavu >> > installed -- why does commit 4bdf4182fe (core-update merge) not >> > display correctly and the parent commit c81457a588 too but the other >> > parent commit 23a59b180b displays nicely? >> >> Leo reported problems with fonts on Debian in >> , but said that fonts installed >> with Guix still worked. I don't know what could cause it to fail on >> your system. > > Thank for the pointer, it seems the same issue. But I am not sure > because I am using the font from Guix. > > Well, I have font-dejavu-2.37 and fontconfig-2.13.1 installed in > ~/.guix-profile from Guix e98689f. > > > When I run > > guix pull --commit=3D4bdf4182fe -p /tmp/bad > > then > > display /tmp/bad/share/info/images/bootstrap-graph.png > > there is an issue. Note that 'imagemagick' is installed in > ~/.guix-profile using the same commit above. > > > The commit 4bdf4182fe is the commit of merge. If I pull from the > (left) parent commit, i.e., the commit c81457a588, > > guix pull --commit=3Dc81457a588 -p /tmp/left > > then > > display /tmp/right/share/info/images/bootstrap-graph.png > > displays nicely and the font is correct. However, if I pull form the > (right) parent commit, i.e., the commit 23a59b180b, > > guix pull --commit=3D23a59b180b -p /tmp/right > > then > > display /tmp/right/share/info/images/bootstrap-graph.png > > displays wrongly. Well, I have changed nothing, considering the > fonts. And the only difference is commit from "master" vs from > "core-updates". And as I explained [1], it always happens when > core-updates is merged. Missing fonts in the manual is another known issue and was not clear from your initial message: . --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl7FpBwACgkQoqBt8qM6 VPq2HAgAzT1DYMiuvKV2BaWKk+ZUkB34j/hUcJ84PArj01kzaj6FIXMaeLETMn2O Qak/+SvYgOm96p4LPihjqxCN//rK3l2G61onp8gSyYBov98v5uaJl7Tfx4NJF6rZ rFeK7YpUuQIbgV7NDxI/+7Jsxji8dpMOadyMZ38Nolv5hOtHT0YQlH4+hl8W4YQf RnAVdvt1RZHE0AUufvoMO93WepUh8s/8h13gu7wMGirgRLSPC3Svq1qno+IXNiwR Mk3Jy/FxPDm2wnBfr8K8ilumT6X1oiftgdOxNprK4usC3iCB48r8j668jWsanxs+ 6yLK1wcOEhC2qtIaZCWv9uue+HYFgw== =/Pb0 -----END PGP SIGNATURE----- --=-=-=--