From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: Received: from mp1 ([2001:41d0:2:4a6f::]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)) by ms11 with LMTPS id GBeqF8cel19yKAAA0tVLHw (envelope-from ) for ; Mon, 26 Oct 2020 19:08:55 +0000 Received: from aspmx1.migadu.com ([2001:41d0:2:4a6f::]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)) by mp1 with LMTPS id Q051E8cel18dFQAAbx9fmQ (envelope-from ) for ; Mon, 26 Oct 2020 19:08:55 +0000 Received: from lists.gnu.org (lists.gnu.org [209.51.188.17]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by aspmx1.migadu.com (Postfix) with ESMTPS id A75139404D3 for ; Mon, 26 Oct 2020 19:08:54 +0000 (UTC) Received: from localhost ([::1]:54044 helo=lists1p.gnu.org) by lists.gnu.org with esmtp (Exim 4.90_1) (envelope-from ) id 1kX7rR-0002bt-JG for larch@yhetil.org; Mon, 26 Oct 2020 15:08:53 -0400 Received: from eggs.gnu.org ([2001:470:142:3::10]:52398) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1kX7qj-0002Zf-Ei for help-guix@gnu.org; Mon, 26 Oct 2020 15:08:09 -0400 Received: from 8.mo3.mail-out.ovh.net ([87.98.172.249]:48350) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1kX7qf-0006rU-Ah for help-guix@gnu.org; Mon, 26 Oct 2020 15:08:08 -0400 Received: from player788.ha.ovh.net (unknown [10.108.54.13]) by mo3.mail-out.ovh.net (Postfix) with ESMTP id 6A2CA267DEA for ; Mon, 26 Oct 2020 20:07:53 +0100 (CET) Received: from hubert-lombard.website (lns-bzn-44-82-249-250-90.adsl.proxad.net [82.249.250.90]) (Authenticated sender: contact@hubert-lombard.website) by player788.ha.ovh.net (Postfix) with ESMTPSA id 821C3178CC51A for ; Mon, 26 Oct 2020 19:07:52 +0000 (UTC) Date: Mon, 26 Oct 2020 20:07:50 +0100 From: Hubert Lombard To: help-guix@gnu.org Subject: Some (little) problems about contributing to the translation of guix-manual Message-ID: <20201026200750.01660142@hubert-lombard.website> X-Mailer: Claws Mail 3.17.8 (GTK+ 2.24.32; x86_64-pc-linux-gnu) MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Ovh-Tracer-Id: 2200289897100141875 X-VR-SPAMSTATE: OK X-VR-SPAMSCORE: 0 X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedujedrkeejgdekhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfqggfjpdevjffgvefmvefgnecuuegrihhlohhuthemucehtddtnecunecujfgurhepfffhvffukffogggtgfesthhqfedtredtjeenucfhrhhomhepjfhusggvrhhtucfnohhmsggrrhguuceotghonhhtrggttheshhhusggvrhhtqdhlohhmsggrrhgurdifvggsshhithgvqeenucggtffrrghtthgvrhhnpeegteekvdeugfegjeeugefhgfetteekjeeileehueehleegtdejuedtjeehfeegueenucffohhmrghinheptddqphhrvgdvrdhfrhenucfkpheptddrtddrtddrtddpkedvrddvgeelrddvhedtrdeltdenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepmhhouggvpehsmhhtphdqohhuthdphhgvlhhopehplhgrhigvrhejkeekrdhhrgdrohhvhhdrnhgvthdpihhnvghtpedtrddtrddtrddtpdhmrghilhhfrhhomheptghonhhtrggttheshhhusggvrhhtqdhlohhmsggrrhgurdifvggsshhithgvpdhrtghpthhtohephhgvlhhpqdhguhhigiesghhnuhdrohhrgh Received-SPF: pass client-ip=87.98.172.249; envelope-from=contact@hubert-lombard.website; helo=8.mo3.mail-out.ovh.net X-detected-operating-system: by eggs.gnu.org: First seen = 2020/10/26 15:07:53 X-ACL-Warn: Detected OS = Linux 3.11 and newer X-Spam_score_int: -18 X-Spam_score: -1.9 X-Spam_bar: - X-Spam_report: (-1.9 / 5.0 requ) BAYES_00=-1.9, RCVD_IN_DNSWL_NONE=-0.0001, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_HELO_NONE=0.001, SPF_PASS=-0.001 autolearn=ham autolearn_force=no X-Spam_action: no action X-BeenThere: help-guix@gnu.org X-Mailman-Version: 2.1.23 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: help-guix-bounces+larch=yhetil.org@gnu.org Sender: "Help-Guix" X-Scanner: scn0 Authentication-Results: aspmx1.migadu.com; dkim=none; dmarc=none; spf=pass (aspmx1.migadu.com: domain of help-guix-bounces@gnu.org designates 209.51.188.17 as permitted sender) smtp.mailfrom=help-guix-bounces@gnu.org X-Spam-Score: -1.01 X-TUID: lDN4q+N0uL1g Hello guix! Trying to contribute to the French translation for guix-manual, I encounter= some problems. Everything I tried to translate was mostly done under Guix System with Gtra= nslator. A little bit with poedit too, but... when I go under debian (dual-= boot), I find that translations done under Guix System are apparently not s= een, for example : With Guix System : $ msgfmt -cv guix-manual-1.2.0-pre2.fr.po 8471 messages traduits, 813 traductions approximatives, = 602 messages non traduits. =20 With debian : $ msgfmt -cv guix-manual-1.2.0-pre2.fr.po=20 8459 messages traduits, 825 traductions approximatives, = 602 messages non traduits. =20 Du coup, I don't know if the 12 translated messages and the 12 approximate = translations set have been taken into account or not. But I think not... Fr= om time to time, I have the impression to redo some translations/modificati= ons. The first time I tried poedit under Guix System, I thought I saw a stealthy= message like "translation error" or something like that. The following tim= es, this message didn't appear anymore. Could it be a localization problem? In order to test, I created /usr/share/= locale/en/LC_MESSAGES which currently contains en_en.msg, messages.mo, my_f= ile.po and test.mo (These files come from gtranslator and poedit, in which = I have previously entered the path to /LC_MESSAGES. Then I searched in the Guix System tree if I could find a location correspo= nding to the locales, but I couldn't find anything like that. Otherwise, I encountered a setback due to my inexperience with the translator roster. I hadn't gone through the whole procedure and only yesterday I received the approval from the FSF: "Hubert Lombard has been successfully subscribed to the Translators mailing list", (my registration details having remained cached for about 2 or 3 weeks, the validation worked). It was the robot that asked me to satisfy this requirement. But I was a bit lost because I know that Guix does not require copyright. So I sent a mail to the french translation team manager and he answered me asking me details about guix, guix-packages and guix-manual. I answered him that I was only working on guix-manual, the translator of the other 2 being already assigned to them. His r=C3=A9ponse : "Ok, I will register you without reservation" Today I tried again to send the .po file on which I made some progress, but= it was rejected: "According to my notes, Hubert Lombard is not a member of= the French team." Well, I think it's just a matter of time ;-) No other errors were mentioned= . There is a message that informs me about what still needs to be translate= d, but it doesn't look like an injunction, just an information > 8534 trans= lated messages, 750 fuzzy translations, 602 untranslated messages. I'm a bit nervous, knowing that 1.2.0 is about to be released, I was wonder= ing if I would have time to send my version before the deadline. I'm curren= tly at over 86%. If you have any comments, please let me know. Wishing you a good evening, Friendly, --=20 Hubert