From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: Received: from mp2 ([2001:41d0:2:4a6f::]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)) by ms11 with LMTPS id SN44BVzqv14qMAAA0tVLHw (envelope-from ) for ; Sat, 16 May 2020 13:27:56 +0000 Received: from aspmx1.migadu.com ([2001:41d0:2:4a6f::]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)) by mp2 with LMTPS id +PkWAVzqv17HHwAAB5/wlQ (envelope-from ) for ; Sat, 16 May 2020 13:27:56 +0000 Received: from lists.gnu.org (lists.gnu.org [209.51.188.17]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by aspmx1.migadu.com (Postfix) with ESMTPS id 5ACFF940BB1 for ; Sat, 16 May 2020 13:27:55 +0000 (UTC) Received: from localhost ([::1]:48750 helo=lists1p.gnu.org) by lists.gnu.org with esmtp (Exim 4.90_1) (envelope-from ) id 1jZwr3-0001Uk-IM for larch@yhetil.org; Sat, 16 May 2020 09:27:53 -0400 Received: from eggs.gnu.org ([2001:470:142:3::10]:53292) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1jZwqu-0001UA-U4 for help-guix@gnu.org; Sat, 16 May 2020 09:27:44 -0400 Received: from out4-smtp.messagingengine.com ([66.111.4.28]:33141) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1jZwqt-0005Cc-M8 for help-guix@gnu.org; Sat, 16 May 2020 09:27:44 -0400 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id A3D255C0084; Sat, 16 May 2020 09:27:40 -0400 (EDT) Received: from mailfrontend1 ([10.202.2.162]) by compute4.internal (MEProxy); Sat, 16 May 2020 09:27:40 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm2; bh=0VwuAscGAFjA8xAVrUJLczdVFw Xi8un1ejp/i+874Yk=; b=vWfIYtlA38SIRWmD/c4+0amiJ3Y0SlJcn2ACGuYBCl CwCMRxjF6UC+a3GoMR0e4AtYfk9KjMbaOfFBYJkuQmX98CD+J7sTrHMHr+USnj+B DYdekWVkZjq5fTys3Xu9IEjwe3f6Ryil+YsDcmJyc7Uz+FXJtRpfR2+IbEarQDXn Lrh/bXuKb8GaEJftEGr91uvuRFOK5L99aBp/Wx/iZZkvywuV+AoMoLwoUBn63OSJ i8nA5izRl2WaPKaQT19W+7uqpyYXchM7aFqzgr5CR2uPS+HZWeYn/jpLxfOZc3kb da6PkFwSYUKc8jGi21EfYZeDjIkOdpfhjTIIP10oNo6A== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=0VwuAs cGAFjA8xAVrUJLczdVFwXi8un1ejp/i+874Yk=; b=OnJ/57sDbx6Zx0lMIEBhne HZlFTsPpDikEzh+FJb4Cj98wpeWZiRmlqe5ovhDEfEDFMr9/sBLj9PopGWG6S7JR ceQI5bnUH67NyVF9D6bhQ36PVEzmIroYJR06kzMyv8cDSOHNkPaHaoTxtdvu2wpL /FkkILdRbaPSOD1dpQFS9jVLrkQVpUPjpV8dYsvz50wm3dT+onZqqfnCmU774i23 o/OUWuPmpl/MdLkYef3OI6PjrrtI64CMOuzhw/lnMHvlpb28wAM9Hnxd7rttR6CZ PTs1oshv0ZV61RfeePCNBKi/PVh8GLg36G3iGHuVudHXI0EPdVJviM2JptfVk6OQ == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduhedruddttddgieegucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmne cujfgurhephffvufgjfhgffffkgggtsehgtderredtreejnecuhfhrohhmpeforghrihhu shcuuegrkhhkvgcuoehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhmqeenucggtffrrg htthgvrhhnpeektdelffevvedtledvvedugeffieffhfelgeehtedugedvgeeguedujefh jefhteenucfkphepkeegrddvtddvrdeikedrjeehnecuvehluhhsthgvrhfuihiivgeptd enucfrrghrrghmpehmrghilhhfrhhomhepmhgsrghkkhgvsehfrghsthhmrghilhdrtgho mh X-ME-Proxy: Received: from localhost (ti0006q161-2604.bb.online.no [84.202.68.75]) by mail.messagingengine.com (Postfix) with ESMTPA id DC60D328005D; Sat, 16 May 2020 09:27:39 -0400 (EDT) From: Marius Bakke To: Christophe Pisteur , Tobias Geerinckx-Rice Subject: Re: How to configure a printer on Guix System In-Reply-To: <88cd379a43f606eedd3eba50f726718eb0f346d1.camel@fsfe.org> References: <25916d1e0db98b12dc5d631cd7c03e28e11410a4.camel@fsfe.org> <87eerljjqr.fsf@nckx> <88cd379a43f606eedd3eba50f726718eb0f346d1.camel@fsfe.org> User-Agent: Notmuch/0.29.3 (https://notmuchmail.org) Emacs/26.3 (x86_64-pc-linux-gnu) Date: Sat, 16 May 2020 15:27:37 +0200 Message-ID: <878shst3g6.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" Received-SPF: pass client-ip=66.111.4.28; envelope-from=mbakke@fastmail.com; helo=out4-smtp.messagingengine.com X-detected-operating-system: by eggs.gnu.org: First seen = 2020/05/16 09:27:40 X-ACL-Warn: Detected OS = Linux 2.2.x-3.x [generic] [fuzzy] X-Spam_score_int: -27 X-Spam_score: -2.8 X-Spam_bar: -- X-Spam_report: (-2.8 / 5.0 requ) BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, FREEMAIL_FROM=0.001, RCVD_IN_DNSWL_LOW=-0.7, RCVD_IN_MSPIKE_H3=0.001, RCVD_IN_MSPIKE_WL=0.001, SPF_HELO_PASS=-0.001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001 autolearn=_AUTOLEARN X-Spam_action: no action X-BeenThere: help-guix@gnu.org X-Mailman-Version: 2.1.23 Precedence: list List-Id: List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Cc: help-guix@gnu.org Errors-To: help-guix-bounces+larch=yhetil.org@gnu.org Sender: "Help-Guix" X-Scanner: scn0 Authentication-Results: aspmx1.migadu.com; dkim=pass header.d=fastmail.com header.s=fm2 header.b=vWfIYtlA; dkim=pass header.d=messagingengine.com header.s=fm2 header.b=OnJ/57sD; dmarc=pass (policy=none) header.from=fastmail.com; spf=pass (aspmx1.migadu.com: domain of help-guix-bounces@gnu.org designates 209.51.188.17 as permitted sender) smtp.mailfrom=help-guix-bounces@gnu.org X-Spam-Score: -3.81 X-TUID: d24mzrB5EhM2 --=-=-= Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Christophe Pisteur writes: > Le vendredi 15 mai 2020 =C3=A0 17:33 +0200, Tobias Geerinckx-Rice a =C3= =A9crit : >> Christophe, >>=20 >> Christophe Pisteur =E5=86=99=E9=81=93=EF=BC=9A >> > Since now, I installed the following packages: cups,=20 >> > cups-filters, >> > fomatics-filters. >> > When I launch http: // localhost: 631 / in my browser >>=20 >> So the important thing to (un)learn here is that installing Guix=20 >> packages will never start random software in the background. This=20 >> is by design. >>=20 >> (Guix) System software is started by services that are part of=20 >> your OPERATING-SYSTEM. Here's part of my laptop's CUPS=20 >> configuration: >>=20 >> (use-service-modules =C2=B7=C2=B7=C2=B7 >> cups >> =C2=B7=C2=B7=C2=B7) >> (operating-system >> (services >> (cons* =C2=B7=C2=B7=C2=B7 >> (service cups-service-type >> (cups-configuration >> (extensions >> (list hplip-minimal >> ;; Required to display printer options, >> ;; even with IPP Everywhere everywhere. >> cups-filters >> ;; Other possible legacy drivers: >> ;; escpr foo2zjs foomatic-filters >> ;; hplip-minimal splix >> )) >> (server-name host-name) >> (host-name-lookups #t) >> (web-interface? #t) >> (default-paper-size "A4") >> ;; You get the idea. >> =C2=B7=C2=B7=C2=B7)) >> =C2=B7=C2=B7=C2=B7 >> %base-services-or-whatever))) > > Thank you for the explanation and for sharing this configuration. My > problem is that I still don't understand guix well enough: I don't know > in which file to write this configuration of cups (name and path), nor > with what tool to define it (nano, terminal, etc.). Guix is deceptively simple. This goes in your /etc/config.scm, like any other system-level change. You probably already have a (services ...) in there: the challenge is to sew in the stanza provided by Tobias with your existing configuration. Afterwards you need to run 'guix system reconfigure /etc/config.scm'. > Perhaps I do not have enough computer background to use guix to date. > It does not matter, I will eventually learn over time, not to mention > that some functions will be automated with the evolution of the > project, as is the case for the graphic installation. You should not need a computer background to use Guix. In fact _no_ background may be better, as Guix is radically different from any other operating system you may have used (unless you come from NixOS). The only thing required is patience to read the manual, and the courage to ask on IRC or mailing lists if you get stuck. :-) --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl6/6kkACgkQoqBt8qM6 VPqheQf/YwRMEAKFeyYaOEM+bnHHt1S2b3g289nZFPH49jZGCPgh78mpshhZ/RkC GEZAe9pZ0n6h87Or27aj00YrE2oo6ae284HTqGymTY7sq7ez8Bb5FR3C86Nw643B zeRe5ppG6xnO4/UBAqb/+loXRa9B2MCI6SZ2yYFlwPjs6n8RR9qmayAzzEqms67J wbAQkg8ZcRC9P1GHX7g+0lLGoYS/dZU9Pc+fW7GMfrYEeFbHtTL/fvHGeAcVT3W6 cW41k1fz64i0A2uzBbKznWf4359mJ+2VGyKrVN9DIB8/6Sq+tLlxImFNrafVL+xy r/2IPfgnddrLYcG8DedgB6LOG+nS3Q== =9DN1 -----END PGP SIGNATURE----- --=-=-=--