From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: Received: from mp1 ([2001:41d0:2:4a6f::]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)) by ms11 with LMTPS id KI0dFJxitV5/VAAA0tVLHw (envelope-from ) for ; Fri, 08 May 2020 13:46:04 +0000 Received: from aspmx1.migadu.com ([2001:41d0:2:4a6f::]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)) by mp1 with LMTPS id wIs9OqhitV7iGAAAbx9fmQ (envelope-from ) for ; Fri, 08 May 2020 13:46:16 +0000 Received: from lists.gnu.org (lists.gnu.org [IPv6:2001:470:142::17]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by aspmx1.migadu.com (Postfix) with ESMTPS id C0F88940F29 for ; Fri, 8 May 2020 13:46:14 +0000 (UTC) Received: from localhost ([::1]:44230 helo=lists1p.gnu.org) by lists.gnu.org with esmtp (Exim 4.90_1) (envelope-from ) id 1jX3KR-0001iQ-8h for larch@yhetil.org; Fri, 08 May 2020 09:46:15 -0400 Received: from eggs.gnu.org ([2001:470:142:3::10]:36586) by lists.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_256_GCM_SHA384:256) (Exim 4.90_1) (envelope-from ) id 1jX3JG-0007k3-By for bug-guix@gnu.org; Fri, 08 May 2020 09:45:02 -0400 Received: from debbugs.gnu.org ([209.51.188.43]:33233) by eggs.gnu.org with esmtps (TLS1.2:ECDHE_RSA_AES_128_GCM_SHA256:128) (Exim 4.90_1) (envelope-from ) id 1jX3JF-0007tR-WF for bug-guix@gnu.org; Fri, 08 May 2020 09:45:02 -0400 Received: from Debian-debbugs by debbugs.gnu.org with local (Exim 4.84_2) (envelope-from ) id 1jX3JF-0001ja-U0 for bug-guix@gnu.org; Fri, 08 May 2020 09:45:01 -0400 X-Loop: help-debbugs@gnu.org Subject: bug#41116: Guix deploy fails with new version of Herd Resent-From: Marius Bakke Original-Sender: "Debbugs-submit" Resent-CC: bug-guix@gnu.org Resent-Date: Fri, 08 May 2020 13:45:01 +0000 Resent-Message-ID: Resent-Sender: help-debbugs@gnu.org X-GNU-PR-Message: followup 41116 X-GNU-PR-Package: guix X-GNU-PR-Keywords: To: Diego Nicola Barbato , Ludovic =?UTF-8?Q?Court=C3=A8s?= Received: via spool by 41116-done@debbugs.gnu.org id=D41116.15889454836621 (code D ref 41116); Fri, 08 May 2020 13:45:01 +0000 Received: (at 41116-done) by debbugs.gnu.org; 8 May 2020 13:44:43 +0000 Received: from localhost ([127.0.0.1]:44779 helo=debbugs.gnu.org) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jX3Ii-0001iU-JZ for submit@debbugs.gnu.org; Fri, 08 May 2020 09:44:43 -0400 Received: from out3-smtp.messagingengine.com ([66.111.4.27]:40895) by debbugs.gnu.org with esmtp (Exim 4.84_2) (envelope-from ) id 1jX3Ig-0001iH-V8 for 41116-done@debbugs.gnu.org; Fri, 08 May 2020 09:44:27 -0400 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailout.nyi.internal (Postfix) with ESMTP id 8E0955C0238; Fri, 8 May 2020 09:44:21 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute4.internal (MEProxy); Fri, 08 May 2020 09:44:21 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=fastmail.com; h= from:to:cc:subject:in-reply-to:references:date:message-id :mime-version:content-type; s=fm2; bh=JmchjHPj3D2ouArBXlc8nB2UAH 9hN9TZugmf7VIO7Fo=; b=CC0XkvJNhcCq/PLyqt6RpEwpx0yFai00hOjAsExWh0 vdtWdC8ZSRuDF84nyNOdR114fUFWSBXhhemK3yt0Wlyt0NbDNVKd8WvuI87PWuAc cMKYITJKdJp1tWCEq29vasiQsC5rhJsQGq5kPscrHDgw5zy1ScN71qBIIFrZzQ0Y g2rG3OnMsnkZfrFEellKx7JxBsJtKzXIS/Svct3mTTL+F6FOkqM6mm9KoCdRbqUh dPs26M0CBih63urQtV+RApvKfOKKSOnqGsmT6YstMU8cVUCHduJ2gXMkKOFv1ICR KzuKUBmRJPk+rsdzEsIYj3Tate5P2xwf4A65ZxMrkd8w== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; bh=JmchjH Pj3D2ouArBXlc8nB2UAH9hN9TZugmf7VIO7Fo=; b=sn6P2P+Jt1r3UCa4dZ+ZO6 9gbF6/ws0C95TViTBxmzAr1QEbWQ3j0INvPeZO9Zdj2pxhLijtG92Xtv5/FcLaMD EfszIltnImPkFQhtP3tB/UNiI93Z0SUeTcuovUlfIvFj7pZkuZw2pqRM7kTuY3gh SKOvp9RQeu96/ORE5VNH6PXpcj0kR2oAsE6CigMOfPtDQHmC6oko19QjjQDKfoht thltUDuwnYRf+Pd7a2hxlO/CSoVOJLOtEXnFTZFef9WMBu/0cWhpXHaDqG0oklwP a0xFqS9wADjjnIyxLAx40Ct3VVtufXX177/j8nE4gRid7yHPXrj9HtpOUlnb5qwg == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduhedrkeefgddtvdcutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenuc fjughrpefhvffujghffgffkfggtgesghdtreertderjeenucfhrhhomhepofgrrhhiuhhs uceurghkkhgvuceomhgsrghkkhgvsehfrghsthhmrghilhdrtghomheqnecuggftrfgrth htvghrnhepkedtleffveevtdelvdevudegffeifffhleegheetudegvdeggeeuudejhfej hfetnecukfhppeekgedrvddtvddrieekrdejheenucevlhhushhtvghrufhiiigvpedtne curfgrrhgrmhepmhgrihhlfhhrohhmpehmsggrkhhkvgesfhgrshhtmhgrihhlrdgtohhm X-ME-Proxy: Received: from localhost (ti0006q161-2604.bb.online.no [84.202.68.75]) by mail.messagingengine.com (Postfix) with ESMTPA id 98E333065E69; Fri, 8 May 2020 09:44:20 -0400 (EDT) From: Marius Bakke In-Reply-To: <875zd7na9y.fsf@GlaDOS.home> References: <877dxog0wf.fsf@komputilo.eu> <87pnbg3coi.fsf@devup.no> <871rnwdj5p.fsf@gnu.org> <875zd7na9y.fsf@GlaDOS.home> User-Agent: Notmuch/0.29.3 (https://notmuchmail.org) Emacs/26.3 (x86_64-pc-linux-gnu) Date: Fri, 08 May 2020 15:44:18 +0200 Message-ID: <87eeru35jh.fsf@devup.no> MIME-Version: 1.0 Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature" X-Spam-Score: -0.7 (/) X-BeenThere: debbugs-submit@debbugs.gnu.org X-Mailman-Version: 2.1.18 Precedence: list X-Spam-Score: -1.0 (-) X-BeenThere: bug-guix@gnu.org List-Id: Bug reports for GNU Guix List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Cc: 41116-done@debbugs.gnu.org, Alex Sassmannshausen Errors-To: bug-guix-bounces+larch=yhetil.org@gnu.org Sender: "bug-Guix" X-Scanner: scn0 X-Spam-Score: -2.01 Authentication-Results: aspmx1.migadu.com; dkim=fail (rsa verify failed) header.d=fastmail.com header.s=fm2 header.b=CC0XkvJN; dkim=fail (rsa verify failed) header.d=messagingengine.com header.s=fm2 header.b=sn6P2P+J; dmarc=fail reason="SPF not aligned (relaxed)" header.from=fastmail.com (policy=none); spf=pass (aspmx1.migadu.com: domain of bug-guix-bounces@gnu.org designates 2001:470:142::17 as permitted sender) smtp.mailfrom=bug-guix-bounces@gnu.org X-Scan-Result: default: False [-2.01 / 13.00]; RCVD_VIA_SMTP_AUTH(0.00)[]; GENERIC_REPUTATION(0.00)[-0.4989626877212]; TO_DN_SOME(0.00)[]; R_SPF_ALLOW(-0.20)[+ip6:2001:470:142::/48:c]; R_DKIM_REJECT(1.00)[fastmail.com:s=fm2,messagingengine.com:s=fm2]; DWL_DNSWL_FAIL(0.00)[2001:470:142::17:server fail]; FREEMAIL_FROM(0.00)[fastmail.com]; IP_REPUTATION_HAM(0.00)[asn: 22989(0.10), country: US(-0.00), ip: 2001:470:142::17(-0.50)]; DKIM_TRACE(0.00)[fastmail.com:-,messagingengine.com:-]; MX_GOOD(-0.50)[cached: eggs.gnu.org]; MAILLIST(-0.20)[mailman]; SIGNED_PGP(-2.00)[]; FORGED_RECIPIENTS_MAILLIST(0.00)[]; RCVD_IN_DNSWL_FAIL(0.00)[2001:470:142::17:server fail]; MIME_TRACE(0.00)[0:+,1:+,2:~]; RCVD_TLS_LAST(0.00)[]; ASN(0.00)[asn:22989, ipnet:2001:470:142::/48, country:US]; TAGGED_FROM(0.00)[larch=yhetil.org]; FROM_NEQ_ENVFROM(0.00)[mbakke@fastmail.com,bug-guix-bounces@gnu.org]; ARC_NA(0.00)[]; URIBL_BLOCKED(0.00)[gnu.org:email,posteo.de:email,fastmail.com:email]; FROM_HAS_DN(0.00)[]; RCPT_COUNT_THREE(0.00)[4]; MIME_GOOD(-0.20)[multipart/signed,text/plain]; HAS_LIST_UNSUB(-0.01)[]; RCVD_COUNT_SEVEN(0.00)[10]; FORGED_SENDER_MAILLIST(0.00)[]; DMARC_POLICY_SOFTFAIL(0.10)[fastmail.com : SPF not aligned (relaxed),none] X-TUID: R3tZd/uBA9Td --=-=-= Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable Diego Nicola Barbato writes: > Hey, > > Ludovic Court=C3=A8s writes: > >> Hello Alex & Marius, >> >> Marius Bakke skribis: >> >>> Alex Sassmannshausen via Bug reports for GNU Guix >>> writes: >>> >>>> Hello, >>>> >>>> I maintain a number of servers using Guix deploy. It seems that the >>>> recent upgrade to Herd in Guix, and specifically commit >>>> 4c0cc7bed3de2c0e2d3a6e95b88693941e839eec might have introduced a bug. >>>> >>>> From my testing, guix deploy currently consistently fails with: >>>> -----------------8<----------------------------->8------------------- >>>> ice-9/boot-9.scm:1667:16: In procedure raise-exception: >>>> ERROR: >>>> 1. &inferior-exception: >>>> arguments: (srfi-34 #" "Unrecognized keyword" () (#:file-creation-mask)= )] 7eff2bd7be00>>) >>>> inferior: #f >>>> stack: () >>>> -----------------8<----------------------------->8------------------- >>>> >>>> A workaround is to build the system configuration locally on the target >>>> server, then to reconfigure. It will still error at the same place, b= ut >>>> at this point, after restarting the server, the new version of Herd wi= ll >>>> be running and both deploy and reconfigure will work. >>>> >>>> I don't know what a good solution to this could be, but it may be >>>> something we need to consider in future development of Herd. >>> >>> This issue has been reported by a number of users on IRC. I think the >>> problem is that the the #:file-creation-mask keyword requires support >>> from the running Shepherd, which may not have it yet. I think we should >>> revert commit 4c0cc7bed3de2c0e2d3a6e95b88693941e839eec until we find a >>> smooth upgrade path. Can you try it and push if that fixes guix deploy? >> >> I=E2=80=99ve reverted the patch in 5aa4d2dcf2f4f8786358feb45338893ed08a4= cd9. >> >> Diego: I guess we can reinstate the patch =E2=80=9Clater=E2=80=9D, once = Shepherd 0.8 can >> be considered widespread. > > I'm sorry I broke reconfigure and deploy. I didn't consider testing > upgrading from before Shepherd 0.8 to after my change and I didn't even > think of deploy. Going forth I'll leave messing with core functionality > to the pros. Mistakes happen, don't worry about it. One thing that would be really useful and can prevent such situations in the future is to have a "system test" that tries to run reconfigure from the latest released version of Guix (currently 1.1.0). There are already a few Shepherd tests in gnu/tests/base.scm and gnu/tests/reconfigure.scm that can be used as inspiration. Food for thought, patches welcome, etc. :-) --=-=-= Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAEBCgAdFiEEu7At3yzq9qgNHeZDoqBt8qM6VPoFAl61YjIACgkQoqBt8qM6 VPo5Tgf/Ywil3T2XY/cMzIsHfAcfVJ+vFJCjFsKTyRnSCjHjLWpD6GBX27jbsTmh cMFdO0PNPn0lG0jOhGoWdg1dxlAD5BMjrYdXCEvYIrnG49VPxd/5JkJMSMoUKpN3 fOf8Ki959fxiFZpwFmbuqat5f7b34faMSm0h8kKoGzqj4oNJhfx1miq9ewP5jAVw bhRSCohWywjgkAqrmAW7FBh26E1i0Rv4/FeUsH4nhTYH5Bg46eSn85SnsuyCwI7L oyzcNvr+uJHlh1B5rV/Udi6dfmEWAd3JiJA/ebrlGtSHRqQhjN3FYcpaKII4rMYx uo9mkTRdJ2LFi37ZHTJ9ym92xW9J8g== =RZPU -----END PGP SIGNATURE----- --=-=-=--